The 10 Best Ecommerce Agencies in Essex (2024)

Best Ecommerce Agencies in Essex

Featured providers

  • TekRevol DMCC

    TekRevol DMCCcertified-flagverified-flagfeatured-flag

    5
    (53 reviews)

    Empowering Businesses through Digital Transformation

    Recommended
    Award-winner
    A digital transformation company offering full-stack mobile app development solutions for startups and enterprise-level clients. TekRevol has been listed as one of the best mobile app development solutions providers on various industry review websites. Moreover, we are also listed in the list of 5000 fastest-growing firms globally by Inc. After US and Ukraine, we have also laid our footprints in the GCC region and have an office in Dubai, UAE.
    21 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • TRIARE

    TRIAREcertified-flagverified-flagfeatured-flag

    4.9
    (10 reviews)

    TRIARE unlocks IT potential of YOUR business

    Recommended
    Award-winner
    TRIARE is a WEB and MOBILE software development company based in Europe. We are delighted to offer our services as your long-term partner, taking all technical matters off your shoulders and allowing you to focus on your business development. YOU WILL GET: ✔ In-house team . Work with a dedicated team that is 100% focused on your product and located in the same office. ✔ Efficiency & transparency , as our process is based on Scrum methodology and managed by certified Scrum Masters. ✔ Fast result. Working with us, you will get the first result in 1 week. ✔ High quality, as TRIARE has well-established processes of software development and experienced specialists. ✔ Full cycle development . Our company covers all stages of development, handling everything from Discovery and prototyping to Design, development, and maintenance. ✔ IP rights . From the very beginning, you are the only owner of the intellectual property of your project materials: source code, design, documentation, etc. ✔ Warranty period will be provided for your system for free. ASPECTS OF OUR MINDSET: - Focused on results. We are focused on the result of your business with an understanding of the real goals and KPIs that our team should achieve. - Solution Provider. It means that we always come to you with solutions, not with questions. We take all technical aspects of the project off your shoulders, allowing you to focus on the marketing and business strategies. - We go the extra mile. Being a proactive company, we always think and take a step ahead. TECHNOLOGIES WE USE: - Mobile app development: Kotlin, Java, Swift, Objective-C. - Cross-platform development: Flutter, React Native. - Web frameworks: Node.JS, React.JS, PHP, Ruby on Rails.
    4 works in E-commerce
    Active in Essex, United Kingdom
    From €10000 for E-commerce
  • OMTech Masters

    OMTech Masterscertified-flagverified-flagfeatured-flag

    5
    (5 reviews)

    ⭐⭐⭐⭐⭐ Web Development Done Right

    Recommended
    Award-winner
    OMTech is a web development company headquartered in Leicester, UK. When it comes to selecting the best web development company for your business, OMtech is an agency you can trust. Rest assured, when you partner with us, you are shaking hands with a strong ally who can make your digital dreams come true. Established in 2013, we are a UK-based website development company with clients who come to us for highly skilled and future-proof web coding, at a fair price and stay with us for our commitment to supporting their digital businesses for the long term. We are a small team of boutique software developers who are obsessed with technology! Over the last 10 years, our team have worked on pretty much every type of project – custom coded web apps, full scale eCommerce websites, robust content sites and much more. This experience goes into each and every project we work on. The team shares a passion for web development of all types of projects, and supports our clients’ business success by delivering best-practice, web solutions. We believe in: 1. A great relationship with our clients 2. Outcome-Driven work process 3. Being affordable without sacrifice 4. Sharing the value of our experience Please contact us if you need any help and we will get back to you as soon as possible. The Sales and Technical Support offices are open: Mon-Fri 8:00am - 7:00pm Emergency Technical Support is available 24 hours a day, 7 days a week.
    10 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • GRM Digital

    GRM Digitalcertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    Reach your digital potential

    Award-winner
    We’re GRM Digital, an award-winning, full-service web development and digital marketing agency based in Leeds, London, Sarajevo, Amsterdam and Islamabad. Since 2009, we've been helping world-leading brands grow by providing high-quality, robust web development, SEO and digital consultancy, backed by in-depth research and analysis.
    2 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • CMOLDS UAE

    CMOLDS UAEcertified-flagverified-flagfeatured-flag

    5
    (45 reviews)

    Shape the Present; MOLD the Future!

    Recommended
    Award-winner
    CMOLDS, a mobile app and software development company in UAE, boards some of the smartest brains in the mobile industry and acquires a proven track record in the iOS and Android app stores. Our designers and developers follow a strategic approach for each project to cater to custom requirements as intended.
    16 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Priodev Media

    Priodev Mediacertified-flagverified-flagfeatured-flag

    5
    (11 reviews)

    Priodev is a new type of Digital Agency, except we’ve been around for years.

    Recommended
    Priodev is more than just a digital services company. Our team are experts in the latest technologies. We provide consultancy on everything from websites, social media, marketing campaigns – even digital events! And if you need help with your branding or logo, our graphic designers will be happy to help you out…
    1 work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce

Best Ecommerce Agencies in Essex

Sort by
  • Duck.design

    Duck.designcertified-flagverified-flagfeatured-flag

    4.9
    (30 reviews)

    You need design done. Just get it!

    Recommended
    Award-winner
    Your brand designs are too important to be left in the hands of unreliable freelancers or expensive creative agencies. Why not hire an experienced, full-time designer who knows you by name and your brand by heart? Since its creation, Duck.design has been able to capitalize on a number of areas that currently constitute its strength: - Logo, Brand Guide, Style Guide; - Graphic Design; - Web Design; - UI/UX Prototyping; - 3D Design; - Game design; - Explainer Video, 2D Animation, GIF.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Cab Engine | Digital Agency

    Cab Engine | Digital Agencycertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    We specialise in building high-performance teams to power your entire marketing engine.

    Recommended
    Award-winner
    A trusted UK agency of 20 years, our unique partnership model has been the foundation for our client's success. Working with brands all over the world, our dedicated digital teams have driven significant results for our clients tech platforms and performance marketing.
    4 works in E-commerce
    Active in Essex, United Kingdom
    From €10000 for E-commerce
  • TechGropse Pvt. Ltd.

    TechGropse Pvt. Ltd.certified-flagverified-flagfeatured-flag

    4.9
    (53 reviews)

    Let’s Give Wings To Your App

    Recommended
    Award-winner
    TechGropse is an Indian-based mobile app development company that specialises in providing one of the best solutions worldwide. Having over 7+ years of experience in this industry, we provide functional application, maintenance and support services. Our team of professionals are well-versed in building applications using different technologies such as IoT, Blockchain, AR/VR and many more. As a customer-oriented agency, we understand the requirements of our clients and try to fulfil them on time. Our team of experienced professionals are also passionate about their work, doing everything with dedication. They are well-versed in building modern and fast-loading applications, including modern technologies and trends. This agency completed several projects worldwide at a pocket-friendly price. As a leading name, it understands the value of time, which is why it makes sure that the project is delivered on time. Our professional team is proficient in easily completing complex projects and troubleshooting issues that may affect your project. We Can Help You With: Provide quality mobile app development services. Streamlining the testing procedure in order to detect issues and features efficiently without sacrificing quality. Partnership Advantages: Deep knowledge of different programming languages 100% transparency Effective communication Dedicated team with years of experience UX testing Technology we Use Programming Objective-C Swift Flutter React Kotlin Framework React Ionic Google Fit SDK AR Core Google Assistant SDK UI/UX Design Photoshop Illustrator Sketch Figma XD Backend PHP .Net Laravel Node.Js Python Cloud Amazon AWS Microsoft Azure Google Cloud Digital Ocean Firebase We are committed to providing you with ultimate solutions that are modern and advanced. We work with several enterprises and provide one of the best services to all our customers. In order to opt for the best services, contact us for a free consultation.
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • IDS Group

    IDS Groupcertified-flagverified-flagfeatured-flag

    5
    (6 reviews)

    Your 5 star Web Development Agency

    Recommended
    Award-winner
    We provide UX/UI Design, Custom Web Development, Product Development, Tech Support, QA and SEO services. Get in touch today. https://calendly.com/itdevstaff | itdevstaff.com | London, UK
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • redPepper Marketing

    redPepper Marketingverified-flagfeatured-flag

    (0 review)

    Energise, Propel & Transform your marketing

     redPepper Marketing is a full-service agency offering both digital and traditional marketing to B2B and B2C businesses. From one-off campaigns to integrated annual marketing programmes, we create and deliver marketing that gets results for you. For over 22 years, we have worked with businesses, charities and organisations in three core marketing disciplines – strategy, content and digital.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €400 for E-commerce
  • Proeze

    Proezecertified-flagverified-flagfeatured-flag

    (0 review)
    Proeze, a leading web designing, digital marketing, online branding, and software development company in the U.K. owns a dedicated and young team of industry experts who are committed to delivering the best solutions to the clients. We are a cybersecurity backed company that has a partnership with GoDaddy, one of the largest domain registrars and hosting service provider in a cost-effective package. We are also certified Google and Bing Partners. We are a 100% customer-oriented company that provides exceptional support and service to the clients. Proeze stands for commitment and diligence to the core values in reaching a standard goal no matter what the work or challenge is. Engage with us to get the desired results. Contact us today and know-how can we help improve your digital presence.   We work with next-generation strategies and techniques to enhance your digital presence and reputation. Our vision is to simplify the relationship between the search engine and website to increase revenue and provide an outstanding web experience. We influence our profound understanding and knowledge of client's business domain requirements to create the best solution tailored to their requirements.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Magecom

    Magecomcertified-flagverified-flagfeatured-flag

    (0 review)
    Here at Magecom, we transform online businesses into thriving success stories. With over 10 years of expertise as a leading agency in eСommerce and being Magento/Adobe, Shopify, and Shopware partners, we are here to elevate your brand to new heights. We specialize in providing comprehensive services tailored to your needs. Whether you're a B2B, B2C, or C2C online store, marketplace, multi-store, auction platform, or subscription website, we have the expertise to develop advanced functionalities that will set you apart from the competition. ✔ Our team is dedicated to enhancing your website's performance and user experience. We excel in optimizing site speed, improving response time, and efficiently handling high traffic to ensure your customers have a seamless and enjoyable browsing experience. ✔ We understand the importance of seamless integrations with third-party systems to streamline business operations. Whether integrating with ERP, CRM, PIM, shipping and payment methods, marketing and analytics tools, or social media and marketplaces, we have the skills and knowledge to seamlessly connect your store, empowering you to manage your online presence efficiently. ✔ Security and reliability are paramount in the digital landscape. Our experts ensure your website is kept up and running, robustly secure, and in optimal health. With our vigilant monitoring and proactive maintenance, you can focus on your business while we care for your online presence. ✔ In an ever-evolving digital world, staying ahead of the competition is crucial. Our talented designers will revitalize your website's appearance, incorporating modern UX/UI practices to enhance the shopping experience and captivate your customers. We strive to create an attractive look and feel that reflects your brand's uniqueness. ✔ Attracting relevant traffic and increasing your conversion rate are key factors for success. Our team specializes in driving targeted traffic to your website, utilizing effective strategies to increase engagement and boost sales. Through personalized recommendations and modern AI technologies, we help you sell even more at every step of your client's journey. ✔ In addition to our core services, we offer turn-key eCommerce solutions, seamless integrations, resolution of technical issues, UX/CRO optimization, personalized recommendations, traffic increase, team augmentation, and more. Our goal is to provide you with a comprehensive suite of services that meet your business needs and help you achieve remarkable results. Contact us today, and let us empower your online business to achieve unprecedented success. Together, we'll build a remarkable digital future for your brand 🧡
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Bear Creative

    Bear Creativecertified-flagverified-flagfeatured-flag

    (0 review)

    Little Bear, Big Ideas.

    We are a Creative Agency based in Essex, UK - our goal is simple, we are committed to helping you build an online presence from the ground up.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €100 for E-commerce
  • TLMT®

    TLMT®certified-flagverified-flagfeatured-flag

    (0 review)

    Inspired by marketing

    TLMT® is a strategy-led full-service marketing agency. By uncovering insights on competitors, and key areas of opportunities and delivering effective campaigns based on tangible objectives, our dedicated & ambitious team of marketing individuals will be with you every step of the way!
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Geoffreymatthew

    Geoffreymatthewcertified-flagverified-flagfeatured-flag

    (0 review)
    "Harlow's leading estate agency, dedicated to helping you seamlessly find your dream home or expertly sell your property with personalized guidance and unparalleled professionalism. #buyPropertiesInHarlow #BuyPropertiesInHarlow#BuyPropertyInHarlow"
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • The Techno Studio UK

    The Techno Studio UKcertified-flagverified-flagfeatured-flag

    5
    (184 reviews)

    DGITAL MARKETING & ADVERTISING AGENCY

    Recommended
    The Techno Studio UK is expanding its sphere of influence to grow local businesses in the United States. The creativity of the London-based social advertising agency is applied to manage small startups in the online marketing arena. Our expertise provides full-time IT solutions in the B2B industry.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Rozee Digital - Ecommerce Marketing Agency

    Rozee Digital - Ecommerce Marketing Agencycertified-flagverified-flagfeatured-flag

    3.7
    (4 reviews)

    Driving Growth for $1M to $100M eCommerce Brands With Paid Search, Paid Social and Email Marketing

    Recommended
    Award-winner
    Scaling Your Customer Generation. Thats What Makes Us Different! Stop throwing money away on outdated agencies who haven’t changed their strategy since post iOS14. To succeed in eCommerce 2023, you have to change your strategy! This is where everything starts at Rozee Digital. Our Customer Generation Strategy is designed to transform our client partners into 7 & 9-figure powerhouse brands.
    7 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Civitta

    Civittacertified-flagverified-flagfeatured-flag

    5
    (8 reviews)

    The Collaboratory. A place where initiative meets inquisitiveness.

    Award-winner
    Civitta challenges the traditional norms of consulting as an international collaboratory, blending digital and advisory services for public and private clients from the Nordics to Central Asia. Together, the Group encompasses more than 30 legal entities in more than 20 countries.
    9 works in E-commerce
    Active in Essex, United Kingdom
    From €3000 for E-commerce
  • The Organic Agency

    The Organic Agencycertified-flagverified-flagfeatured-flag

    4.9
    (7 reviews)

    Unlocking digital progress.

    Recommended
    Award-winner
    We work with brands to create positive digital experiences to improve their customers’ lives. ‘Digital For Good’ is at the centre of everything we do. It impacts on the way we work, the work we do, and the clients we choose to work with. And it’s not just in our everyday work that we’re using digital to make a difference. Here’s how we tie it all together to make the greatest impact possible:
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €3306 for E-commerce
  • Liss Solutions

    Liss Solutionscertified-flagverified-flagfeatured-flag

    5
    (4 reviews)

    Empowering Your Digital Journey with Innovative Solutions.

    Recommended
    Award-winner
    Liss Solutions is a dynamic company that offers a wide range of digital services to clients all over the world. Our team of skilled professionals is dedicated to providing top-quality services in web design and development, software design and development, social media management, graphic design, virtual assistance, and data entry. We pride ourselves on our ability to work collaboratively with our clients to create custom solutions that meet their specific needs and exceed their expectations. With years of experience in the industry, we have the knowledge and expertise to help our clients achieve their goals and grow their businesses. At Liss Solutions, we are committed to delivering outstanding results and building long-lasting relationships with our clients. Contact us today to learn more about how we can help you achieve your digital goals.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Qlaunch Gmbh

    Qlaunch Gmbhcertified-flagverified-flag

    5
    (2 reviews)

    Mobile & Web development | Taking you from concept to launch

    Recommended
    Award-winner
    Qlaunch Gmbh are the experts in enterprise applications. We dream up innovative digital solutions and optimise their delivery for better user experience and faster time-to-market. As well known for our inclusive, friendly culture as we are for our deep expertise, our team comprises some of the brightest and most passionate people in IT; together, we strive for excellence and relish opportunities to collaborate and apply our passion for technology. Our expert teams in mobile development and partner with our enterprise clients to transform the way society interacts with technology.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Egara Digital Media

    Egara Digital Mediacertified-flagverified-flag

    4.3
    (15 reviews)

    Crux of Digital Media

    Recommended
    Award-winner
    We're thrilled to have you join us on this exciting journey through the dynamic world of digital marketing. At EGARA, we're more than just a company – we're a team of passionate digital enthusiasts who are dedicated to helping you unlock the full potential of your brand. In this fast-paced digital landscape, having a strong online presence is essential, and that's where we come in. Our expert team is armed with the latest strategies and cutting-edge techniques to elevate your brand, drive engagement, and create meaningful connections with your target audience. Whether you're a small startup aiming to make a big impact or an established business looking to stay ahead in the digital race, EGARA Digital Media is here to guide you every step of the way. From innovative social media campaigns to strategic SEO solutions, from captivating content creation to data-driven insights – we've got it all covered. Your success is our success, and we're committed to tailoring our services to meet your unique goals and aspirations. Get ready to witness your brand's growth and influence expand like never before. Once again, welcome to the EGARA family. Here's to an incredible partnership and a future filled with digital achievements!
    No work in E-commerce
    Active in Essex, United Kingdom
    From €700 for E-commerce
  • The SEO Works

    The SEO Workscertified-flagverified-flag

    4.8
    (3 reviews)

    The Digital Growth Experts

    Recommended
    Award-winner
    The SEO Works are an award-winning provider of digital marketing, websites and social for leading brands and prospering SME's across the UK. We help businesses measure, understand, and maximise their online potential. Our expert team is made up of content managers, link builders, brand managers, web techies and experienced online marketers who work together to provide measurable results for our clients. We pride ourselves on delivering top-quality results that are based on proven techniques and an intimate, dynamic knowledge of ethical online marketing practices. The SEO Works is a certified Google Partner for search advertising (SEO) and Google Adwords (PPC). We are also part of the exclusive Google elevator programme. “Best B2C marketing campaign” - Drum Search Awards "Marketing Effectiveness Winner" - Summit International Awards “Excellence in Professional Services” - Chambers of Commerce Awards "Platinum Award for B2C" - AVA Digital Awards
    1 work in E-commerce
    Active in Essex, United Kingdom
    From €3000 for E-commerce
  • AnjasDev

    AnjasDevcertified-flagverified-flag

    (0 review)

    Expert Digital Marketing | Amplified Growth Strategies

    Launched in 2010, AnjasDev is a premier full-service digital marketing agency based in Modesto, CA. The AnjasDev mission is to provide the most effective digital marketing solutions in the industry, a high-touch customer experience, deliver results, and use profits to reinvest in client success, employee success, and the community. AnjasDev is one of the highest-awarded digital marketing agencies in the industry and works with some of the biggest brands in the world.
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Magneto IT Solutions UK Ltd.

    Magneto IT Solutions UK Ltd.verified-flag

    5
    (24 reviews)

    Empowering Digital Transformation

    Recommended
    Award-winner
    We are Magneto. A team of digital commerce experts working with manufacturers, wholesalers and retailers globally, turning ideas into unique customer & content-centric experiences, using a platform-agnostic approach. Since 2010, we have been architecting digital commerce solutions for our clients providing innovative solutions, managing delivery and accelerating the speed at which leading B2B, B2C, D2C and marketplace brands can scale with flexibility their online offerings. We empower enterprises with industry-leading composable commerce solutions through a range of partners which offer PIM, DAM, OMS, MDM, DEM, CRM, CX, omnichannel sales, and marketing business needs. We push ourselves. We push technology. And we push the boundaries of conventional commerce.
    4 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Fourmeta

    Fourmetaverified-flag

    5
    (8 reviews)

    Fourmeta is building for the future now.

    Recommended
    Award-winner
    Welcome to Fourmeta, where innovation meets excellence in the digital realm. As a dynamic full-stack digital agency and a distinguished Shopify Partner, we're here to propel your online presence to new heights. With a comprehensive suite of services spanning design, web development, and digital marketing, we're your one-stop destination for all things digital. Our Commitment to Your Success At Fourmeta, our mission is clear: to empower your brand in the ever-evolving digital landscape. Whether you're a budding startup or an established enterprise, we have the expertise, creativity, and technical prowess to transform your vision into reality. Our Multifaceted Services Design Excellence: Our award-winning designers are masters of visual storytelling. They craft captivating user experiences and visually stunning designs that leave a lasting impression. From UI/UX design to motion graphics, we infuse creativity into every pixel. Web Development Mastery: Web applications are the lifeblood of modern businesses. Our development team specializes in creating robust, scalable, and feature-rich web solutions. From e-commerce platforms to custom web applications, we turn your ideas into interactive digital experiences. Digital Marketing Wizardry: In a world of digital noise, your message deserves to be heard. Our digital marketing experts employ cutting-edge strategies to boost your online visibility, drive targeted traffic, and convert visitors into loyal customers. From SEO to social media marketing, we're your digital marketing partner. Why Choose Fourmeta? Expertise: Our team comprises seasoned professionals with years of industry experience. We're passionate about staying at the forefront of digital innovation and leveraging the latest technologies to benefit your business. Tailored Solutions: We don't believe in one-size-fits-all solutions. Every project is unique, and we tailor our services to your specific needs, ensuring a perfect fit. Customer-Centric: Your satisfaction is our top priority. We're dedicated to providing exceptional customer service and building long-lasting partnerships. Results-Driven: We're not just about pretty designs and fancy code. We're about delivering tangible results that boost your bottom line. Ready to embark on a transformative digital journey? Fourmeta is your trusted partner every step of the way. Whether you're looking to revamp your website, launch a new e-commerce venture, or supercharge your digital marketing efforts, we have the expertise to turn your aspirations into reality. The future of your brand is just a click away. Contact us today, and let's discuss how Fourmeta can empower your digital success. Together, we'll navigate the digital landscape, overcome challenges, and seize opportunities. Join us on this exciting journey to digital excellence. +44 7873 677326 | fourmeta.com | London, UK
    10 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Poppins

    Poppinscertified-flagverified-flag

    5
    (2 reviews)

    We are a house of strategy, creative, social and digital technology specialists.

    We craft beautiful brand expressions, digital experiences and products. All underpinned by thoughtful strategy. We’re driven to help our clients be the best version of themselves through the power of brand and digital. Because we’re certain there is something uniquely special inside each and every business.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €3000 for E-commerce
  • Nice Digital Studio

    Nice Digital Studioverified-flag

    5
    (17 reviews)

    We specialize in web development, SEO and web design to make your business successful

    Award-winner
    Reach out to the team of Nice Digital Studio professionals and take your business to the next level. Our agency helps businesses bring in new customers by increasing online visibility.  We are proud of our service and results: 🌍 150+ clients worldwide; 🛒 Cooperation with brands such as Toyota, Reebok, Adidas, and Hoorman; 💸 The most competitive prices on the market; ⌨️ Full customer support even after the work is completed; 👍 98% of our clients were satisfied with the services they received. 43% of clients returned to us for additional services! Our main services are website development, web design, SEO optimization, and Google advertising. It is this combination that works effectively every time. And thanks to the professionalism of our team, your business results improve significantly. We always strive to exceed your expectations and do more than just get the job done. That is why our clients choose us. You can read their reviews on Сlutch ( https://clutch.co/profile/nice-digital-studio ) and our website ( https://nicedigitalstudio.com ). Contact us today to find out how we can help your business grow! We will analyze your website for free!
    7 works in E-commerce
    Active in Essex, United Kingdom
    From €526 for E-commerce
  • Liberty Marketing Ltd

    Liberty Marketing Ltdcertified-flagverified-flag

    (0 review)

    Unleashing online performance for brands that demand better.

    Award-winner
    We offer digital marketing consultancy, strategy, training and delivery. Our expertise includes SEO, Paid Media (PPC), Social Media, Content Creation and Digital PR.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Vertical Brands

    Vertical Brandscertified-flagverified-flag

    (0 review)

    We build and transform brands through best-in-class strategy, creativity & performance marketing.

    Our reality has gone virtual – with new platforms, creators and trends in constant flux. Vertical was built to help brands stay at the forefront of what’s next. We innovate and create digital experiences that bring forth the best possible growth solutions for our partners. Our team helps brands rise to the challenges of communicating with consumers in today’s complex and ever-changing digital ecosystem. In doing so, combine creative ingenuity with data-led performance marketing that win the hearts and minds of consumers while delivering for the bottom-line.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Sciart Marketing is a UK based Data Marketing Agency that help brands to navigate and deliver improved business outcomes across all your marketing channels, we do this by applying a value driven approach leveraging marketing data and business strategy. In today’s complex and ever changing world, companies need to be quicker and more nimble than ever before, not only understand, but also be able to react to the ever changing consumer needs and external factors as technology advances and the competitor landscape evolves. With Sciart Marketing you will have a flexible partner that enables you to be agile and responsive in this VUCA world. We work with ambitious brands and progressive companies to deliver data driven marketing with a strong focus on Value and Trust delivered by great people and technology.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • GROW ECOMMERCE

    GROW ECOMMERCEcertified-flagverified-flag

    (0 review)
    No work in E-commerce
    Active in Essex, United Kingdom
    From €10000 for E-commerce
  • Globevitamin

    Globevitamincertified-flagverified-flag

    (0 review)
    Globevitamin stands as the epitome of excellence in the UK's healthcare, supplement, and wellbeing landscape. Our commitment to quality is unwavering, with each product in our extensive inventory sourced from trusted brands renowned for their efficacy and reliability. From vitamins and supplements to herbal remedies and skincare solutions, Globevitamin provides a comprehensive selection tailored to meet the diverse needs and preferences of our valued customers. https://globevitamin.com/
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Agifly

    Agiflycertified-flagverified-flag

    4.6
    (11 reviews)

    We build digital solutions that work for you! Let's bring your ideas to life!

    Recommended
    Award-winner
    Agifly, a top tier Belgian digital partner. We were founded in 2019 and are based in Brussels with a team of 20 enthusiastic technologists. We help you transforming your ideas into seamless digital experiences, with support every step of the way. We really listen to you and your users, we execute incrementally to ensure alignment and we make implementation easy.  
    7 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • CDN Solutions Group

    CDN Solutions Groupverified-flag

    5
    (7 reviews)

    Blockchain Solutions, NFT, Mobile App development company, Software Development Company

    Recommended
    Award-winner
    At CDN Solutions Group, we are pioneers in delivering cutting-edge technological solutions tailored to meet the diverse needs of businesses across the globe. With a relentless focus on innovation and a commitment to excellence, we empower organizations to thrive in the digital era through our comprehensive suite of services, including custom software development, mobile application development, blockchain solutions, IoT integration, and AI development . Custom Software Development: Our custom software development services are designed to address the unique requirements of businesses, ranging from startups to enterprise-level organizations. Leveraging the latest technologies and industry best practices, we develop bespoke software solutions that streamline operations, enhance productivity, and drive growth. Mobile App Development: In today's mobile-first world, having a robust mobile presence is crucial for businesses to stay competitive. Our team of experienced developers specializes in creating feature-rich, intuitive mobile applications for iOS, Android, and cross-platform environments. From concept to deployment, we work closely with our clients to ensure their mobile apps are engaging, user-friendly, and aligned with their business objectives. Blockchain Solutions: As blockchain technology continues to revolutionize various industries, we help businesses harness its potential to drive efficiency, transparency, and security across their operations. Whether it's developing decentralized applications (DApps), implementing smart contracts, or integrating blockchain into existing systems, our experts possess the technical expertise to deliver tailored blockchain solutions that unlock new opportunities for our clients. IoT Integration: The Internet of Things (IoT) has transformed the way businesses collect, analyze, and leverage data from interconnected devices. Our IoT integration services enable organizations to capitalize on this paradigm shift by seamlessly connecting disparate devices, sensors, and systems to facilitate real-time data exchange, automate processes, and drive informed decision-making. AI Development: Artificial Intelligence (AI) is reshaping industries by enabling machines to replicate human-like cognitive functions. At CDN Solutions Group, we leverage the power of AI to develop intelligent solutions that automate tasks, personalize user experiences, and uncover valuable insights from vast datasets. Whether it's machine learning, natural language processing, or computer vision, our AI development capabilities empower businesses to stay ahead of the curve in today's data-driven world. Why Choose CDN Solutions Group: Expertise: Our team comprises seasoned professionals with extensive experience in their respective domains, ensuring the highest quality of service delivery. Innovation: We stay at the forefront of technology trends and continuously explore new opportunities to drive innovation and create value for our clients. Collaboration: We believe in fostering strong, collaborative partnerships with our clients, working closely with them to understand their unique needs and deliver tailored solutions that exceed expectations. Reliability: With a proven track record of delivering successful projects on time and within budget, our clients can trust us to consistently meet their technology requirements. Conclusion: At CDN Solutions Group, we are more than just a technology partner – we are catalysts for innovation, driving positive change and helping businesses thrive in the digital age. Whether you're looking to develop custom software, mobile apps, blockchain solutions, IoT integrations, or AI-driven applications, we have the expertise and resources to bring your vision to life. Partner with us today and embark on a journey of digital transformation that will propel your business to new heights.
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Webwax Ltd

    Webwax Ltdcertified-flag

    (0 review)
     
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  •  
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • BNZONES

    BNZONEScertified-flag

    (0 review)
    Full Service Digital Agency, You Can Trust Get set ready go SERVICES What We Do DIGITAL MARKETING SOCIALMEDIA MANAGEMENT BRANDING SEARCH ENGINE OPTIMIZATION E-MAIL MARKETINGINFLUENCER MARKETING Learn More CONSULTING DIGITAL MARKETING BUSINESS GROWTH STARTUP CONSULTING BUSINESS CONSULTING Learn More WEB / APP DESIGN & DEVELOPMENT E-COMMERCE WORDPRESS MOBILE APP PHP/JP DEVELOPMENT Learn More DATA ENTRY SERVICES E-COMMERCE […]
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • JS Web Dev Ltd.

    JS Web Dev Ltd.certified-flag

    (0 review)
    Joe Stone is a freelance WordPress web design expert based in Essex, providing support for web development agencies and businesses who want great websites.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • We're an award winning web design and development agency with a decade of experience providing bespoke services in the heart of Essex
    No work in E-commerce
    Active in Essex, United Kingdom
    No budget for E-commerce
  • Full service design agency based in Cambridge and Essex, servicing London. We offer design for print as well as digital branding and website development
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • The domain name MediaBrothers.co.uk is for sale. Make an offer or buy it now at a set price.
    No work in E-commerce
    Active in Essex, United Kingdom
    No budget for E-commerce
  • LA Search

    LA Searchcertified-flag

    (0 review)
    Try using professional SEO services company to increase organic traffic on your website! Local SEO agency (London) gives you more users and revenue from free traffic - LA Search
    No work in E-commerce
    Active in Essex, United Kingdom
    No budget for E-commerce
  • Mr Seo is a Transparent & ROI inspired freelance SEO consultant & specialist from Essex & London. Get in touch to maximise your organic traffic!
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • We are the leading web application and online marketing company in UK who provides professional web design, website development, SEO,internet marketing,we hosting and online branding services in UK
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Bee Spotted

    Bee Spottedcertified-flag

    (0 review)
    We are the leading Essex Marketing SEO Agency offering the best Search engine optimization Services. Our SEO Essex Marketing experts will help you grow your business online.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Climbing Trees

    Climbing Treescertified-flag

    (0 review)
    Climbing Trees create positive digital marketing, for good. We help brands to achieve more with their paid and organic search marketing.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Fintek Software

    Fintek Softwarecertified-flag

    (0 review)
    SINCE 2014 Custom Software Development Fintek is a software agency in Harlow, Essex. We develop beautiful, maintainable and robust software at any scale for charities, start-ups and financial technology companies.   Bespoke software so you can grow automate save time get more done Book a free consultation Services Chatbots Chatbots powered by natural language processing AI that can […]
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Creatif Agency

    Creatif Agencyverified-flag

    5
    (11 reviews)

    Web Design Agency, at Creatif Agency we help business grow online and boost their ROI

    Recommended
    Award-winner
    Creatif Agency creates timeless websites and unforgettable brands . We design presentation websites, complex ecommerce websites and tailor-made applications, we cover everything needed for your online business. We've worked with clients from multiple industries, and thanks to our unique business model, we can cover any market and timezone that you may think of. From Bucharest to London, from Berlin to San Francisco. We're the most creative company according to our clients. Our Website: https://creatif.agency We work with start-ups and enterprises and showcase online through incredible design and website creation. Delivering creative branding, and high-end digital services, we create pixel perfect websites. Pricing range For our services, the pricing per hour starts at €70/h . For a presentation website, while we would create a custom rate for your needs, pricing can range at €3.500 - €5.000 and can increase based on your needs. If you are interested in learning more about our pricing and services, please don't hesitate to get in touch with us. We would be happy to provide you with a personalized FREE quote based on your specific needs and requirements. Meet us at https://creatif.agency to discuss your project.
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €3000 for E-commerce
  • Dickytall & Sons

    Dickytall & Sonscertified-flagverified-flag

    4.4
    (9 reviews)

    Digital craftsmen by experience!

    Recommended
    An Antwerp based digital agency, driven by ideas, creating relevant and experience driven solutions. Une agence digital basée à Anvers, animée par des idées, créant des solutions pertinentes et axées sur l'expérience. Eine in Antwerpen ansässige Digitalagentur, angetrieben von Ideen, die relevante und erfahrungsorientierte Lösungen schafft.
    1 work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Schparkly Creative

    Schparkly Creativeverified-flag

    5
    (11 reviews)

    We help your brand STAND UP and STAND OUT

    Schparkly Creative is a branding and design studio. We develop and support the brand visions of kick-ass companies who are transforming the way business should be done while making a profit. Inclusivity, diversity, and sustainability are our foundation. Our extensive experience, killer design skills, and creative ingenuity will help your brand STAND UP and STAND OUT. We’re hell-bent on creating positive change in the world. Let’s be a force for good.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • Talosmart

    Talosmartverified-flag

    5
    (7 reviews)

    A global IT Brand of Excellence

    Recommended
    Award-winner
    Talosmart is a Nigeria Information Technology Brand of excellence that offers High quality and easy-to-use bespoke web and mobile applications at affordable prices for business growth worldwide and profit traction. At Talosmart, we specialize in providing custom software development services to businesses of all sizes and industries. Our team of expert software developers uses cutting-edge technologies and agile development methodologies to create bespoke software solutions tailored to meet your unique business requirements. Our software development services include: 1. Custom Software Development: We develop custom software that is tailored to meet the specific needs of your business. Our team has expertise in developing software for a wide range of industries, from healthcare to finance, ensuring that we can create a solution that meets the needs of your business. 2. Web Application Development: We design and develop advanced web applications that are intuitive, responsive, and secure. Our team can develop web applications for a variety of purposes, including customer-facing booking systems, inventory management systems, and e-commerce platforms. 3. Mobile Application Development: We develop custom mobile applications that are designed to meet the needs of your business and its users. Our team has expertise in developing applications for both iOS and Android platforms, ensuring that your business can reach its target audience no matter what their preferred device is. 4. Software Integration: We can integrate your existing software applications with new and emerging technologies, including cloud services, APIs, and other third-party solutions. Our integration solutions are designed to improve your systems' efficiency and productivity while streamlining your workflows and reducing manual processes. At Talosmart, we believe in providing custom software development solutions that are designed to help businesses meet their challenges head-on. Contact us today to learn more about our software development services and discover how we can help take your business to the next level. We will build IT solutions to solve your business or company problems and increase your revenue. We will also automate your business operations. Get in touch with us for cooperate websites, web applications, Software As-A Service (SAAS), Software As-A Product (SAAP), Web 3.0 Apps, BlockChain Solutions, Cryptocurrency apps, E-commerce platforms, Customer Relation Management (CRM) platforms, Financial Technology (FinTech) apps, accounting systems, Human Resources Management (HRM) apps, payroll systems, attendance systems, invoicing systems, Hotel management systems, school portals, job portals, customer information systems, etc. "Think, we will build for you!"
    3 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • atwework

    atweworkverified-flag

    5
    (10 reviews)

    Growth Provider

    Recommended
    We aim to challenge expectations and showcase creativity in order to differentiate ourselves. Our goal is to attract a discerning target audience by boldly conveying our premium values. We design captivating new concepts and enhance existing ones to keep the audience engaged. By tailoring our website and platform to meet specific user needs, we enhance the company's digital appeal.
    No work in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce
  • e:command

    e:commandverified-flag

    5
    (3 reviews)

    We craft memorable eCommerce experiences.

    Recommended
    eCommand excels at eCommerce builds, whether B2B, B2C, ordering platforms or multivendor marketplaces, we’ve done it all. However, we are much, much more than eCommerce developers, online marketing only begins with the site. With over a decade of experience in eCommerce & digital marketing, we can help you select, design and develop the right package for your online presence.
    7 works in E-commerce
    Active in Essex, United Kingdom
    From €1000 for E-commerce

Struggling to choose? Let us help.

Post a project for free and quickly meet qualified providers. Use our data and on-demand experts to pick the right one for free. Hire them and take your business to the next level.


Keep your ecommerce task in Essex closely under control!

For Sortlist it’s a sure thing, working together a firm in Essex is an treasure for your operation in ecommerce.

Enumerating the profuseness of benefits of cooperating with an ecommerce marketing agency and their partners in the household products and political organization sector, would be exceedingly long. But a real profit that we can spell out is that this cooperation is the optimal solution to have access to the latest tools and technology.

Achieving a operation in ecommerce is, as you have surely realized, not often uncomplicated. Our agencies in Essex can therefore help. Smoke out ecommerce marketing agencies that fits your inquiries quickly, thanks to Sortlist.

Sortlist supports to identify the most adapted firm in Essex.

In the meanwhile your firm already realizes that meeting the best company in Essex can be burdensome and you also knows Sortlist is apt to support your project. But maintaining a great accord with this bureau is also of paramount importance to us! our team will therefore also use all resources necessary to initiate a beautiful love story out of your collaborations with our agencies.

Which profits can an ecommerce marketing agency offer?

Because the ecommerce marketing agencies frequently perform with businesses performing in the accounting- and even the household products industry they will, unquestionably, have the means to deal with all your inquiries. You will hence in a flash see that every request can be answered by a company technical in ecommerce in Essex.

Is your company drafting a operation in e-commerce platform maintenance, or is your company seeking a bureau competent in ecommerce for a operation in e-commerce marketing? Then you will undoubtedly dig up your forthcoming associate near Essex on our team. And now we pick out our firms depending on on specific standards, your firm can rest on the fact that the bureaus your firm will meet through our website will be qualified and able to answer your requirements.

Sortlist helps you find the best agency in Essex

Sortlist, from it's debuts until now, developed into a specialist in matchmaking. Companies who wish to smoke out the peerless digital bureau for their activity in ecommerce will now be able to do so, with a fine, efficient and gratis service.